PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g016735m
Common NameCISIN_1g011169mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 384aa    MW: 41268.3 Da    PI: 6.627
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g016735mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.17.9e-331481461
             zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       ++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  orange1.1g016735m  1 MDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHF 48
                       69********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088424.344147IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-21146IPR003851Zinc finger, Dof-type
PfamPF027012.2E-25147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDTKFCYFNN YNVNQPRHFC KNCQRYWTAG GTMRNVPVGA GRRKNKHFAS QYRQILVSSD  60
GVPVTGLETP NSANQQLMLC GDSATTFRPS TGNGTVLKFG PETPLCESME NVLNLRDQKR  120
SVEICTVTCV ENKEEPSSSG SPVTASSIRG NELPESVMQK EQVMMTGSCN ELNMQQSMHC  180
YPVSPWGVPW NPNNVASMEA AQNPSDRVCV PNGSNPGPVQ WCPTTVLAVP GFCAPNIPLQ  240
FVPASYWGMG VWAAGAGNIP LTGSNGCLSP SSSTSNNSCC SGNGSPTLGK HSRDPNLTDE  300
GQSEKCVLVP KTLRIDDPDE ASRSPIWATL GFKPDQKDLK SGGAIFKDFE TKKGGKADVL  360
DGAEILESNP AALSRSHTFQ EST*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443525.10.0hypothetical protein CICLE_v10019872mg
RefseqXP_006479196.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A067FF520.0A0A067FF52_CITSI; Uncharacterized protein
TrEMBLA0A067FF980.0A0A067FF98_CITSI; Uncharacterized protein
STRINGVIT_08s0056g01230.t011e-171(Vitis vinifera)
STRINGPOPTR_0013s06290.11e-171(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-33cycling DOF factor 2